8 Letter Words
There are 28,406 8-letter words. Generate a random 8-letter word, or browse the full list below.
1,008 are everyday words, the commonest starting letters at this length are S (12%), C (9%), P (8%), and the top Scrabble score available is zyzzyvas (44 points face value).
2 letters3 letters4 letters5 letters6 letters7 letters8 letters9 letters10 letters11 letters12 letters
List of 8-letter words
businessservicesproductssoftwareresearchcommentsnationalshippingreservedsecuritycomputerdownloadpicturespersonallocationchildrenstudentsshoppingpreviouspropertycustomertrainingadvancedcategoryregisterfeaturesindustryprovidedrequiredarticlesfeedbackcompletestandardprogramslanguagepasswordquestionbuildinganalysispossibleproblemsinterestlearningdeliveryoriginalincludesmessagesprovidesspecificdirectorplanningdatabaseofficialdistrictcalendarresourcedocumentmaterialtogetherfunctioneconomicprojectsincludedreceivedarchivesmagazinepoliciespositionlistingswirelesspurchaseresponsepracticehardwaredesigneddiscountrememberincreaseactivityalthoughcontentsregionalsuppliesexchangecontinuebenefitsanythingmortgagesolutionadditionclothingmilitarydecisiondivisionactuallystartingconsumercontractreleasesmultiplefeaturedfriendlyscheduleeveryoneapproachphysicalmedicineevidencefavoriterecentlyprobablynetworkstransferhospitaloverviewdistanceinvolvedpartnersexistingselectedpatientsdirectlysearchesstrategyteachingpositivefootballabstractcontainsrepublicvacationacademicgraphicsexpectedmountainconsidernorthernproposedreportedpoliticsmodifiedreleasedinternaldetailedapprovedsouthernyourselfpressurekeywordspurposesexternalteacherssubjectscapacityrequireselectriccreativeprogressfamiliesacceptedagenciescriticalemployeepackagescoloradorelevantelementsfacilityministervisitorscoverageclinicalsciencescurrencycommerceaccountssettingsculturalholidaysgraduatethinkingprovideroptionalsectionsreligionmeasureschemicalexercisemeetingscongressproducedargumentcreatingattorneyauctionsinformedthoughtsquantityplatformmachinesrecoverymerchantvehiclescampaignexamplesintendedelectionrequestsseparateidentifydomesticextendedsequencemovementprintingbaseballapprovalcontactsmatchingofferingvariablecomparedworkshoplightingportablereturnedwarrantyassemblycriminalpowerfulobtainedsuppliedopinionsmaintainprioritypaymentsstraightpreparedcriteriabehavior
Showing 240 of 28,406 words — common words first.
Highest-scoring Scrabble words
- zyzzyvas44
- bezazzes37
- jazzlike37
- pazazzes37
- pizazzes37
- quizzing36
- zizzling36
- quizzers35
- huzzahed33
- jazziest33
- whizzing33
- buzzwigs32
Looking for a specific opener? Browse words by starting letter.
Frequently asked questions
How many 8-letter words are there?
There are 28,406 8-letter words in our English word list, which is built from the public-domain ENABLE lexicon. 1,008 of them rank as common, everyday words — the list above shows those first.
What are the most common 8-letter words?
The most frequently used include business, services, products, software. Our lists are ordered by real-world frequency, so the words you see first are the ones you are most likely to recognise and play.
What is the highest-scoring 8-letter word in Scrabble?
By face value it is zyzzyvas, worth 44 points before any board bonuses. Face value assumes you could draw the tiles — in a real game, blanks may be needed for words that repeat high-value letters.